What Is LL-37?
LL-37 is supplied as a laboratory research material for controlled experimental work involving antimicrobial-peptide pathway research. The product is intended for analytical, biochemical, molecular, or cellular research according to the experimental design selected by the laboratory.
PQRS supplies LL-37 strictly as a research material. It is not intended for human or veterinary use.
LL-37 Molecular Profile
Chemical Profile
- Molecular Formula: C205H340N60O53
- Molecular Weight: 4493 g/mol
- Sequence / Peptide Notation: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
- PubChem CID: 16198951
Structure and identity reference: PubChem CID 16198951.
2D Molecular Structure
Interactive 3D Structure
Structural Representation: The 2D image and interactive 3D viewer are provided as structural reference materials for laboratory research and molecular identification purposes. The interactive 3D viewer displays Human cathelicidin LL-37, RCSB PDB 2K6O. This experimentally determined solution NMR structure is shown as a peptide-level research reference and does not constitute product-specific analytical confirmation.
Research Context
Laboratory studies may examine molecular identity, receptor or pathway interactions where applicable, stability, assay behavior, and cellular or biochemical responses under defined experimental conditions. Research descriptions should be interpreted as characterization of experimental systems rather than as claims of clinical or consumer outcomes.
Laboratory Research Applications
- Molecular characterization: Evaluation of identity, structure, stability, or other measurable properties relevant to the material.
- Pathway research: Investigation of receptor, signaling, enzymatic, metabolic, or biochemical pathways associated with the material where scientifically applicable.
- Comparative research: Evaluation alongside appropriate controls or related research materials to compare molecular and experimental behavior.
Handling and Preparation
Handle using appropriate laboratory personal protective equipment and validated experimental procedures. Store according to the conditions stated on the product label and accompanying documentation. When preparation of a research solution is required, use an appropriate laboratory solvent and laboratory-specific protocol.
For Research Use Only. Not intended for human or veterinary use.
Research Resources
Researchers should consult product-specific analytical documentation and primary scientific literature when designing or interpreting experiments involving LL-37.
