What Is FOXO4 DRI?
FOXO4 DRI is supplied as a laboratory research material for controlled experimental work involving D-retro-inverso peptide / protein-interaction research. The product is intended for analytical, biochemical, molecular, or cellular research according to the experimental design selected by the laboratory.
PQRS supplies FOXO4 DRI strictly as a research material. It is not intended for human or veterinary use.
FOXO4 DRI Molecular Profile
Chemical Profile
- Molecular Formula: C228H388N86O64
- Molecular Weight: 5358 g/mol
- Sequence / Peptide Notation: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
- PubChem CID: 167312269
- Identity Note: The plain sequence is shown for readability. The PubChem FOXO4-DRI record encodes the retro-inverso peptide with D-configured residues as specified in its biologic description.
Structure and identity reference: PubChem CID 167312269.
2D Molecular Structure

Interactive 3D Structure
Structural Representation: The 2D image is a database-derived molecular structure reference. The interactive 3D viewer is a computational molecular visualization derived from the referenced chemical structure and is not an experimentally determined structure. These representations are provided for molecular identification and structural reference only and do not constitute product-specific analytical confirmation.
Research Context
Laboratory studies may examine molecular identity, physicochemical properties, pathway interactions where applicable, stability, assay behavior, and cellular or biochemical responses under defined experimental conditions. Research descriptions should be interpreted as characterization of experimental systems rather than as claims of clinical or consumer outcomes.
Laboratory Research Applications
- Molecular characterization: Evaluation of identity, composition, structure, stability, or other measurable properties relevant to the material.
- Pathway research: Investigation of signaling, enzymatic, receptor, metabolic, or biochemical pathways associated with the material where scientifically applicable.
- Comparative research: Evaluation alongside appropriate controls or related research materials to compare molecular and experimental behavior.
Handling and Preparation
Handle using appropriate laboratory personal protective equipment and validated experimental procedures. Store according to the conditions stated on the product label and accompanying documentation. When preparation of a research solution is required, use an appropriate laboratory solvent and laboratory-specific protocol.
For Research Use Only. Not intended for human or veterinary use.
Research Resources
Researchers should consult product-specific analytical documentation and primary scientific literature when designing or interpreting experiments involving FOXO4 DRI.

