What Is TB-500?
TB-500 is a synthetic peptide used in laboratory research involving actin-associated cellular processes, cytoskeletal organization, cell migration, and related signaling pathways. It is commonly studied as a research material associated with thymosin beta-4 biology and cellular structural dynamics.
PQRS supplies TB-500 strictly as a laboratory research material. It is not intended for human or veterinary use.
TB-500 / Thymosin Beta-4 Molecular Profile
The current PQRS product identity is treated as full-length thymosin beta-4. The molecular structure shown below references the PubChem record for thymosin beta-4, CID 16132341.
Identity Reference: PubChem CID 16132341 (thymosin beta-4 / timbetasin).
2D Molecular Structure
Interactive 3D Structure
Structural Representation: The 2D image and interactive 3D viewer are provided as structural reference materials for laboratory research and molecular identification purposes. The interactive 3D viewer displays Thymosin beta-4 bound to actin, RCSB PDB 1T44. This experimentally determined structure is shown as an actin-bound thymosin beta-4 research reference and does not represent the isolated peptide or constitute product-specific analytical confirmation.
Research Context
TB-500 is associated with laboratory research involving the actin cytoskeleton, cellular organization, cell migration, and peptide-associated signaling. These systems are important for understanding how cells maintain structure, alter morphology, and respond to controlled experimental conditions.
Research may focus on actin dynamics, cytoskeletal regulation, cellular motility, peptide interactions, and comparisons with other peptide systems involved in cellular signaling and organization.
Laboratory Research Applications
- Actin-associated research: Investigation of actin regulation and cytoskeletal organization in controlled laboratory systems.
- Cell migration studies: Examination of molecular processes associated with cellular motility and movement.
- Cellular signaling: Study of peptide-associated intracellular pathways and cellular responses.
- Comparative peptide research: TB-500 may be evaluated alongside other research peptides to compare molecular behavior, pathway interactions, and cellular signaling characteristics.
Handling and Reconstitution
Handle lyophilized TB-500 using appropriate laboratory personal protective equipment and aseptic technique. Store according to the storage conditions specified on the product label and accompanying documentation. When preparation of a research solution is required, use an appropriate laboratory solvent and validated experimental procedure.
Chemical Profile
- Identity: Full-length Thymosin Beta-4
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Amino Acids: 43
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963 g/mol
- PubChem CID: 16132341
For Research Use Only. Not intended for human or veterinary use.
